McDonnell Genome Institute

Washington University

Transcript

NEAT1:1

Chromosome

chr11

Gene Name

NEAT1

Start

65418471

CPC Label

coding

End

65450093

Cancer

OV

Strand

+

Peptide

AGPVITFMGLQLTWELPSSVSPQIFTQSLR

Modified Peptide

n[145]AGPVITFM[147]GLQLTWELPSSVSPQIFTQSLR

Peptide Length

30

ORF Length

93

Open Reading Frame (ORF)

LSFFPLLPPDLGPHRAGPVITFMGLQLTWELPSSVSPQIFTQSLRVLSDLYKTKCRVTCQGTAIPGKTDRNPSLEEIKLGRRFRVVVRRLAEW

Conservation Score

0.846

PhyloCSF Frame 1

-4.176

No. of Spectra

1

CPC Coding Probability

0.593774

PhyloCSF Frame 2 

-3.877

CNTI Index

noncoding

Max Probability

0.7309

PhyloCSF Frame 3

0

CNTI Score

-0.270580375