McDonnell Genome Institute

Washington University

Transcript

NDUFB2-AS1:1

Chromosome

chr7

Gene Name

NDUFB2-AS1

Start

140695335

CPC Label

noncoding

End

140697077

Cancer

BRCA-Luminal A

Strand

-

Peptide

LSSYAAIDNATNGLIR

Modified Peptide

n[145]LSSYAAIDNATNGLIR

Peptide Length

16

ORF Length

52

Open Reading Frame (ORF)

LQPLPPRLKRFSCLNFPSSWDYRHCARLSSYAAIDNATNGLIRSTGFKAGLA

Conservation Score

0.166

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.032392

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9966

PhyloCSF Frame 3

0

CNTI Score

-0.304982697