McDonnell Genome Institute

Washington University

Transcript

NDUFA6-DT:73

Chromosome

chr22

Gene Name

NDUFA6-DT

Start

42132025

CPC Label

noncoding

End

42135239

Cancer

OV

Strand

+

Peptide

FSIMDLMTFNK

Modified Peptide

n[145]FSIMDLMTFNK

Peptide Length

11

ORF Length

51

Open Reading Frame (ORF)

LPQEQIKSLTASPGLWISVHCSSCLFLFLRGYYLRQLRFSIMDLMTFNKLS

Conservation Score

0.986

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0333056

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8426

PhyloCSF Frame 3

0

CNTI Score

-0.448488976