McDonnell Genome Institute

Washington University

Transcript

NDUFA6-DT:43

Chromosome

chr22

Gene Name

NDUFA6-DT

Start

42090932

CPC Label

noncoding

End

42137605

Cancer

LUAD

Strand

+

Peptide

NAGGTAAREAVGSSGK

Modified Peptide

n[230]NAGGTAAREAVGSSGK

Peptide Length

16

ORF Length

79

Open Reading Frame (ORF)

LTRCQGTDQRPSRADSRAAPWHEGIYRNAGGTAAREAVGSSGKRGLRWLLRVSVVLCPRLFPKKVCPGLRSRPPGDLED

Conservation Score

0.036

PhyloCSF Frame 1

-4.849

No. of Spectra

1

CPC Coding Probability

0.252745

PhyloCSF Frame 2 

-4.02

CNTI Index

noncoding

Max Probability

0.5438

PhyloCSF Frame 3

-5.32

CNTI Score

-0.294956507