McDonnell Genome Institute

Washington University

Transcript

NDFIP2-AS1:2

Chromosome

chr13

Gene Name

NDFIP2-AS1

Start

79421703

CPC Label

noncoding

End

79481005

Cancer

OV

Strand

-

Peptide

DGAAFLEHLR

Modified Peptide

n[145]DGAAFLEHLR

Peptide Length

10

ORF Length

48

Open Reading Frame (ORF)

LTRDGAAFLEHLRTGRPGTRHFLTQRRTWGGDSSLEHSQNAYSKSFVR

Conservation Score

0.995

PhyloCSF Frame 1

-0.227

No. of Spectra

5

CPC Coding Probability

0.0264884

PhyloCSF Frame 2 

-4.096

CNTI Index

noncoding

Max Probability

0.8104

PhyloCSF Frame 3

-0.329

CNTI Score

-0.383080679