McDonnell Genome Institute

Washington University

Transcript

NCK1-DT:34

Chromosome

chr3

Gene Name

NCK1-DT

Start

136849870

CPC Label

noncoding

End

136862019

Cancer

OV

Strand

-

Peptide

ASFQAFNKELSSSTMFGIMTR

Modified Peptide

n[145]ASFQAFNKELSSSTMFGIMTR

Peptide Length

21

ORF Length

64

Open Reading Frame (ORF)

MLIFSLMDLYTIIERAVVSPAITVMVYPKASFQAFNKELSSSTMFGIMTRQTPKMLQTTVAMST

Conservation Score

1

PhyloCSF Frame 1

-5.1

No. of Spectra

1

CPC Coding Probability

0.388706

PhyloCSF Frame 2 

10.081

CNTI Index

noncoding

Max Probability

0.0526

PhyloCSF Frame 3

-4.725

CNTI Score

-0.337701159