McDonnell Genome Institute

Washington University

Transcript

NCAM1-AS1:2

Chromosome

chr11

Gene Name

NCAM1-AS1

Start

113269718

CPC Label

coding

End

113273901

Cancer

OV

Strand

-

Peptide

DLQTLPAK

Modified Peptide

n[145]DLQTLPAK

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

MRDLQTLPAKAPAGGEGPEDRVMAFMPRVTPSWGPSMPQN

Conservation Score

0.97

PhyloCSF Frame 1

-4.755

No. of Spectra

30

CPC Coding Probability

0.772255

PhyloCSF Frame 2 

-3.574

CNTI Index

noncoding

Max Probability

0.926

PhyloCSF Frame 3

-2.929

CNTI Score

-0.269995886