McDonnell Genome Institute

Washington University

Transcript

NCAM1-AS1:1

Chromosome

chr11

Gene Name

NCAM1-AS1

Start

113262732

CPC Label

noncoding

End

113274076

Cancer

PRAD

Strand

-

Peptide

GEFLDAEGTR

Modified Peptide

Peptide Length

10

ORF Length

85

Open Reading Frame (ORF)

LRGEFLDAEGTRAEARRPLGRDAVRLWMRLPHWAGAWVESVSSTTRACHSKSYILHCLAHGTGSLMPVSRVWTEKDFFLEDQNAR

Conservation Score

0.104

PhyloCSF Frame 1

-4.752

No. of Spectra

2

CPC Coding Probability

0.161995

PhyloCSF Frame 2 

-4.531

CNTI Index

noncoding

Max Probability

0.9745

PhyloCSF Frame 3

0.072

CNTI Score

-0.267743025