McDonnell Genome Institute

Washington University

Transcript

NBR2:6

Chromosome

chr17

Gene Name

NBR2

Start

43144217

CPC Label

noncoding

End

43145383

Cancer

LUAD

Strand

+

Peptide

TGETKTEESPASDEAGDK

Modified Peptide

TGETKTEESPASDEAGDK

Peptide Length

18

ORF Length

151

Open Reading Frame (ORF)

LAPTFPAARMPKKKVSSTEGAAMEEPKRRSAQLSAKPPAKVEAKPKKAAAKDKFSDTKVQKKGKGEQRENRPKWLTKKLKKIYLQKTGETKTEESPASDEAGDKEAKSDEYHRPCLISGPCLPSLQFRGIFFLSFFFFLRQSLALSPRLQC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.171317

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7997

PhyloCSF Frame 3

0

CNTI Score

0.661034794