McDonnell Genome Institute

Washington University

Transcript

NBR2:1

Chromosome

chr17

Gene Name

NBR2

Start

43125582

CPC Label

noncoding

End

43145108

Cancer

EOGC

Strand

+

Peptide

VSSTEGAAMEEPK

Modified Peptide

n[145]VSSTEGAAMEEPK

Peptide Length

13

ORF Length

60

Open Reading Frame (ORF)

LAPTFPAARMPKKKVSSTEGAAMEEPKRRSAQLSAKPPAKVEAKPKKAAAKDKFSDTKVQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.343526

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9018

PhyloCSF Frame 3

0

CNTI Score

-0.314450299