McDonnell Genome Institute

Washington University

Transcript

NBAT1:11

Chromosome

chr6

Gene Name

NBAT1

Start

22124464

CPC Label

noncoding

End

22148428

Cancer

EOGC

Strand

-

Peptide

LVLAWLLGR

Modified Peptide

n[145]LVLAWLLGR

Peptide Length

9

ORF Length

40

Open Reading Frame (ORF)

LCRKGLRQQAWAAQTLRIPRVSRLVLAWLLGRLLLSPWLR

Conservation Score

0.021

PhyloCSF Frame 1

-5.577

No. of Spectra

7

CPC Coding Probability

0.066315

PhyloCSF Frame 2 

-5.504

CNTI Index

noncoding

Max Probability

0.8348

PhyloCSF Frame 3

-4.953

CNTI Score

-0.320286211