McDonnell Genome Institute

Washington University

Transcript

NAV2-AS5:3

Chromosome

chr11

Gene Name

NAV2-AS5

Start

19504890

CPC Label

noncoding

End

19505900

Cancer

LUAD

Strand

-

Peptide

ECPNGSLRR

Modified Peptide

n[230]ECPNGSLRR

Peptide Length

9

ORF Length

67

Open Reading Frame (ORF)

LHVKIGHLLCLSTALSKKSWEWSVDILSVMWVMSICSMREEFHQYAERNRGRSYRECPNGSLRRKYS

Conservation Score

0.297

PhyloCSF Frame 1

-5.153

No. of Spectra

4

CPC Coding Probability

0.0166427

PhyloCSF Frame 2 

-5.781

CNTI Index

noncoding

Max Probability

0.9962

PhyloCSF Frame 3

-5.199

CNTI Score

-0.362546813