McDonnell Genome Institute

Washington University

Transcript

NALT1:17

Chromosome

chr9

Gene Name

NALT1

Start

136546220

CPC Label

coding

End

136558224

Cancer

OV

Strand

+

Peptide

EGWGRRGLWAGDSGRPEGAAGTSASR

Modified Peptide

n[145]EGWGRRGLWAGDSGRPEGAAGTSASR

Peptide Length

26

ORF Length

140

Open Reading Frame (ORF)

LHGPVAAALGVQRIDRRQTSLAVIARALDREGWGRRGLWAGDSGRPEGAAGTSASRTDCAPLPQGGPASTRSSVTVLLLPGRRLPKVAPESTNGSGGSAAGAGAALPTCSFRLIYFSTTMPGTGTLCQAWLSARSPKCLP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.939086

PhyloCSF Frame 2 

-3.27

CNTI Index

noncoding

Max Probability

0.3122

PhyloCSF Frame 3

0

CNTI Score

-0.285545803