McDonnell Genome Institute

Washington University

Transcript

NALT1:12

Chromosome

chr9

Gene Name

NALT1

Start

136546165

CPC Label

coding

End

136558224

Cancer

BRCA-Luminal A

Strand

+

Peptide

AFWSFFLR

Modified Peptide

n[145]AFWSFFLR

Peptide Length

8

ORF Length

44

Open Reading Frame (ORF)

MAFWSFFLRRSLTLLPRLECHGAISAHYHLRLPGSSNSPVSASE

Conservation Score

0.031

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.939086

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9883

PhyloCSF Frame 3

0

CNTI Score

0.704645848