McDonnell Genome Institute

Washington University

Transcript

MYLK-AS2:1

Chromosome

chr3

Gene Name

MYLK-AS2

Start

123689643

CPC Label

noncoding

End

123692407

Cancer

PRAD

Strand

+

Peptide

LMVINQTFQGQETISPK

Modified Peptide

‚Äč

Peptide Length

17

ORF Length

41

Open Reading Frame (ORF)

LMVINQTFQGQETISPKLPFETFPEAALSSLSRDSAPTHLL

Conservation Score

1

PhyloCSF Frame 1

-4.115

No. of Spectra

5

CPC Coding Probability

0.0476801

PhyloCSF Frame 2 

-4.995

CNTI Index

noncoding

Max Probability

0.593

PhyloCSF Frame 3

0.435

CNTI Score

-0.3944795