McDonnell Genome Institute

Washington University

Transcript

MYB-AS1:3

Chromosome

chr6

Gene Name

MYB-AS1

Start

135195082

CPC Label

noncoding

End

135195995

Cancer

OV

Strand

-

Peptide

LAVSEELK

Modified Peptide

n[145]LAVSEELK

Peptide Length

8

ORF Length

50

Open Reading Frame (ORF)

MLAVSEELKNCPICILTTKKLEDSGVRVALIYTYSCCFYPFLMLQIALMQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.0190643

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9918

PhyloCSF Frame 3

1.598

CNTI Score

-0.394608384