McDonnell Genome Institute

Washington University

Transcript

MRTFA-AS1:3

Chromosome

chr22

Gene Name

MRTFA-AS1

Start

40521799

CPC Label

noncoding

End

40526707

Cancer

OV

Strand

+

Peptide

LPGSSDSPASASCVAGITGAR

Modified Peptide

n[145]LPGSSDSPASASCVAGITGAR

Peptide Length

21

ORF Length

108

Open Reading Frame (ORF)

LGWYKVRVNVPSLSLLFFFLRRSLVLLARLECTGTISVHCNLRLPGSSDSPASASCVAGITGARHHAQLIFVFLVETGFHHVGWPGWSRSPDFVIHPPRPPKVLGLQA

Conservation Score

0.153

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.156961

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9167

PhyloCSF Frame 3

0

CNTI Score

-0.361236635