McDonnell Genome Institute

Washington University

Transcript

MRPS30-DT:42

Chromosome

chr5

Gene Name

MRPS30-DT

Start

44739982

CPC Label

noncoding

End

44809850

Cancer

CCRC

Strand

-

Peptide

TDLHLSATLSIK

Modified Peptide

TDLHLSATLSIK

Peptide Length

12

ORF Length

43

Open Reading Frame (ORF)

LKKLEKTDLHLSATLSIKGPLVKGGGEICQMHLKQSNSILSEG

Conservation Score

0.042

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.243692

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9949

PhyloCSF Frame 3

0

CNTI Score

0.725352887