McDonnell Genome Institute

Washington University

Transcript

MRPS30-DT:38

Chromosome

chr5

Gene Name

MRPS30-DT

Start

44777265

CPC Label

noncoding

End

44844597

Cancer

OSCC

Strand

-

Peptide

TSGDPPVSASQSAGITGMSNR

Modified Peptide

n[145]TSGDPPVSASQSAGITGM[147]SNR

Peptide Length

21

ORF Length

99

Open Reading Frame (ORF)

LGLQVSATTPSLFCIFLVEMGFHHVGQAGLKLRTSGDPPVSASQSAGITGMSNRARQLISFKNQNKTWFRCKKCGRKVMFHQNLNTCIIYYSIKWTITC

Conservation Score

0.963

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.140683

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8071

PhyloCSF Frame 3

0

CNTI Score

-0.386319701