McDonnell Genome Institute

Washington University

Transcript

MPPED2-AS1:10

Chromosome

chr11

Gene Name

MPPED2-AS1

Start

30584135

CPC Label

noncoding

End

30636595

Cancer

CCRC

Strand

+

Peptide

GLEEIEAEK

Modified Peptide

GLEEIEAEK

Peptide Length

9

ORF Length

38

Open Reading Frame (ORF)

MCMLSSVRLCDWKGLEEIEAEKLSNPELQRSFFSVPEK

Conservation Score

0.027

PhyloCSF Frame 1

-2.039

No. of Spectra

1

CPC Coding Probability

0.0425489

PhyloCSF Frame 2 

-3.711

CNTI Index

noncoding

Max Probability

0.9902

PhyloCSF Frame 3

-4.871

CNTI Score

-0.354618628