McDonnell Genome Institute

Washington University

Transcript

MNX1-AS1:4

Chromosome

chr7

Gene Name

MNX1-AS1

Start

157010905

CPC Label

noncoding

End

157016423

Cancer

OSCC

Strand

+

Peptide

KMCFGINTLCK

Modified Peptide

n[145]KM[147]CFGINTLCK

Peptide Length

11

ORF Length

41

Open Reading Frame (ORF)

LHALPEPSLQPPRKMCFGINTLCKGSTLLSGSIGLGAQALL

Conservation Score

0.049

PhyloCSF Frame 1

-3.899

No. of Spectra

13

CPC Coding Probability

0.200341

PhyloCSF Frame 2 

-3.628

CNTI Index

noncoding

Max Probability

0.8388

PhyloCSF Frame 3

-4.923

CNTI Score

-0.288469161