McDonnell Genome Institute

Washington University

Transcript

MNX1-AS1:2

Chromosome

chr7

Gene Name

MNX1-AS1

Start

157010806

CPC Label

noncoding

End

157017049

Cancer

OV

Strand

+

Peptide

LWLNSGALMSKSMFDNGRK

Modified Peptide

n[145]LWLNSGALM[147]SKSMFDNGRK

Peptide Length

19

ORF Length

43

Open Reading Frame (ORF)

MLQCVNFLAHSDSKLWLNSGALMSKSMFDNGRKSALIGLFSSC

Conservation Score

1

PhyloCSF Frame 1

-1.329

No. of Spectra

1

CPC Coding Probability

0.164941

PhyloCSF Frame 2 

-2.571

CNTI Index

noncoding

Max Probability

0.1529

PhyloCSF Frame 3

-3.227

CNTI Score

-0.280554147