McDonnell Genome Institute

Washington University

Transcript

MMP25-AS1:7

Chromosome

chr16

Gene Name

MMP25-AS1

Start

3051994

CPC Label

noncoding

End

3059335

Cancer

OSCC

Strand

-

Peptide

SGPGPGRGQTHGQPRQTGR

Modified Peptide

n[145]SGPGPGRGQTHGQPRQTGR

Peptide Length

19

ORF Length

44

Open Reading Frame (ORF)

LRSGPGPGRGQTHGQPRQTGRSPRRAGVQWHDLGSLQPLPPGFN

Conservation Score

1

PhyloCSF Frame 1

-4.896

No. of Spectra

14

CPC Coding Probability

0.0340863

PhyloCSF Frame 2 

12.463

CNTI Index

noncoding

Max Probability

0.8117

PhyloCSF Frame 3

0

CNTI Score

-0.273316601