McDonnell Genome Institute

Washington University

Transcript

MMP25-AS1:26

Chromosome

chr16

Gene Name

MMP25-AS1

Start

3053104

CPC Label

coding

End

3055131

Cancer

LUAD

Strand

-

Peptide

LHLPMLTSCLLLCPVSPTPVDCWLSRRPLAQLR

Modified Peptide

LHLPMLTSCLLLCPVSPTPVDCWLSRRPLAQLR

Peptide Length

33

ORF Length

135

Open Reading Frame (ORF)

LHLPMLTSCLLLCPVSPTPVDCWLSRRPLAQLRQQLTMHSMRPRAGPVLRGMGEWLISSASPRHQQAPFSSHFSGEEPETMRLRKLFITSGRTLTYLNSALKPTFSFSVCVTGSHFVTQAAVQWCEHSSLQSQPP

Conservation Score

0.947

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.852052

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0744

PhyloCSF Frame 3

0

CNTI Score

-0.334772358