McDonnell Genome Institute

Washington University

Transcript

MMP25-AS1:19

Chromosome

chr16

Gene Name

MMP25-AS1

Start

3053353

CPC Label

noncoding

End

3058193

Cancer

LUAD

Strand

-

Peptide

KLFITSGR

Modified Peptide

n[230]KLFITSGR

Peptide Length

8

ORF Length

68

Open Reading Frame (ORF)

LTMHSMRPRAGPVLRGMGEWLISSASPRHQQAPFSSHFSGEEPETMRLRKLFITSGRTLTYLNSALKP

Conservation Score

0.947

PhyloCSF Frame 1

-3.361

No. of Spectra

4

CPC Coding Probability

0.209246

PhyloCSF Frame 2 

-2.663

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-4.356

CNTI Score

-0.327396738