McDonnell Genome Institute

Washington University

Transcript

MMP2-AS1:9

Chromosome

chr16

Gene Name

MMP2-AS1

Start

55429439

CPC Label

noncoding

End

55444183

Cancer

OV

Strand

-

Peptide

TAGLQPHTYAPATCPQEHR

Modified Peptide

n[145]TAGLQPHTYAPATCPQEHR

Peptide Length

19

ORF Length

83

Open Reading Frame (ORF)

MKHDCPDVHPGINSTAWSPMVRRTAGLQPHTYAPATCPQEHRTNSKFGNEDNVQGNTGPTPNLGMKIMFSSYIFTPSRAPCSC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0834712

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7612

PhyloCSF Frame 3

0

CNTI Score

-0.421791563