McDonnell Genome Institute

Washington University

Transcript

MKLN1-AS:4

Chromosome

chr7

Gene Name

MKLN1-AS

Start

131309743

CPC Label

noncoding

End

131327776

Cancer

OV

Strand

-

Peptide

EVDSIEAIR

Modified Peptide

n[145]EVDSIEAIR

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

MEVDSIEAIRKPLGKTGLVPCLRSSLSRFLSCVK

Conservation Score

0.204

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0193264

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9686

PhyloCSF Frame 3

0

CNTI Score

-0.351172654