McDonnell Genome Institute

Washington University

Transcript

MKLN1-AS:12

Chromosome

chr7

Gene Name

MKLN1-AS

Start

131309296

CPC Label

noncoding

End

131327779

Cancer

OSCC

Strand

-

Peptide

APLHSSPGNSARPCLK

Modified Peptide

n[145]APLHSSPGNSARPCLK

Peptide Length

16

ORF Length

42

Open Reading Frame (ORF)

MAPLHSSPGNSARPCLKKKKKKKIHLWLSVVVHTCNPSTLGG

Conservation Score

0.052

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0197279

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8473

PhyloCSF Frame 3

0

CNTI Score

-0.351172654