McDonnell Genome Institute

Washington University

Transcript

MIRLET7BHG:8

Chromosome

chr22

Gene Name

MIRLET7BHG

Start

46085996

CPC Label

noncoding

End

46113928

Cancer

PRAD

Strand

+

Peptide

LGATSAASGGAVR

Modified Peptide

Peptide Length

13

ORF Length

169

Open Reading Frame (ORF)

LGATSAASGGAVRGGRGPSRVGTRMPVSCWPSTDDSPPPRVSSAEFLGDIMATPVQMRGSRLPVTASQNAARAFPPSSFLSSSSLSGWWFPAGSRPCWCWPQCPHSQGFGVPAPCAHRACPPESLCPWCVWPAEPRAPVLLSPLSSRVPRRCLWKPRSPIGTKTDCPLG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.376269

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9671

PhyloCSF Frame 3

0

CNTI Score

-0.273180757