McDonnell Genome Institute

Washington University

Transcript

MIR99AHG:41

Chromosome

chr21

Gene Name

MIR99AHG

Start

16070500

CPC Label

noncoding

End

16539825

Cancer

LUAD

Strand

+

Peptide

KLNLYSR

Modified Peptide

n[230]KLNLYSR

Peptide Length

7

ORF Length

45

Open Reading Frame (ORF)

LSVLQGRLQFSTTWKRLYHTHSSSIPCTVNCIRKLNLYSRVWTRI

Conservation Score

0.981

PhyloCSF Frame 1

-2.256

No. of Spectra

9

CPC Coding Probability

0.0593766

PhyloCSF Frame 2 

-4.689

CNTI Index

coding

Max Probability

0.9996

PhyloCSF Frame 3

-4.115

CNTI Score

0.594710722