McDonnell Genome Institute

Washington University

Transcript

MIR99AHG:100

Chromosome

chr21

Gene Name

MIR99AHG

Start

16621781

CPC Label

noncoding

End

16643063

Cancer

OV

Strand

+

Peptide

SSPTEHLVTPTLACQR

Modified Peptide

n[145]SSPTEHLVTPTLACQR

Peptide Length

16

ORF Length

45

Open Reading Frame (ORF)

LMTLSCEIPSPGSSWLKSSPTEHLVTPTLACQRTTPLFPLPTQIL

Conservation Score

0.268

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0728466

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9765

PhyloCSF Frame 3

0

CNTI Score

-0.379783184