McDonnell Genome Institute

Washington University

Transcript

MIR924HG:11

Chromosome

chr18

Gene Name

MIR924HG

Start

39339493

CPC Label

noncoding

End

39800302

Cancer

OV

Strand

-

Peptide

SLAPFQNVLFCLSSFSR

Modified Peptide

n[145]SLAPFQNVLFCLSSFSR

Peptide Length

17

ORF Length

45

Open Reading Frame (ORF)

MGPTDQQHHPLEIGWPEVTLLRSLAPFQNVLFCLSSFSRGTTGFL

Conservation Score

1

PhyloCSF Frame 1

-4.535

No. of Spectra

66

CPC Coding Probability

0.121759

PhyloCSF Frame 2 

-4.448

CNTI Index

noncoding

Max Probability

0.9744

PhyloCSF Frame 3

-4.66

CNTI Score

-0.357855087