McDonnell Genome Institute

Washington University

Transcript

MIR9-3HG:21

Chromosome

chr15

Gene Name

MIR9-3HG

Start

89378562

CPC Label

noncoding

End

89388514

Cancer

HCC

Strand

+

Peptide

LEKQAQTR

Modified Peptide

n[230]LEKQAQTR

Peptide Length

8

ORF Length

237

Open Reading Frame (ORF)

LELDPELGKLEKQAQTRKPRYGKSLSKESFPRFTPRLHQGTAWAYGLPNPKRPQPRAGIRPSGREGRRRPQSAGAGGARPQDARGWVGRREGRQQARGCFPSVRTAGPGGHFESAKRGGKMAAWAPGRSPRQGPAEPLLPFVQPRGPQKRNARRERPVRSPQTDARLFITARPRGKSGCRLPAHSPPDPPSRLPGPRSRSRRARLCVSWLLGRKRLPDMLWSQKTAKREAEAPVARV

Conservation Score

1

PhyloCSF Frame 1

0.419

No. of Spectra

7

CPC Coding Probability

0.144284

PhyloCSF Frame 2 

1.612

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

0

CNTI Score

-0.266070722