McDonnell Genome Institute

Washington University

Transcript

MIR9-3HG:11

Chromosome

chr15

Gene Name

MIR9-3HG

Start

89375361

CPC Label

noncoding

End

89398489

Cancer

OV

Strand

+

Peptide

LDLHHRPEFVL

Modified Peptide

n[145]LDLHHRPEFVL

Peptide Length

11

ORF Length

59

Open Reading Frame (ORF)

LVKSRLFVYCRTVLGGISQGFSLLLGWRWTWKMELERDLGTMATLLGRLDLHHRPEFVL

Conservation Score

0.313

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.259096

PhyloCSF Frame 2 

-4.72

CNTI Index

noncoding

Max Probability

0.6452

PhyloCSF Frame 3

-4.922

CNTI Score

-0.324853355