McDonnell Genome Institute

Washington University

Transcript

MIR7-3HG:17

Chromosome

chr19

Gene Name

MIR7-3HG

Start

4769132

CPC Label

noncoding

End

4774021

Cancer

OSCC

Strand

+

Peptide

AMVAGGVYWGSIIEFVDT

Modified Peptide

n[145]AM[147]VAGGVYWGSIIEFVDT

Peptide Length

18

ORF Length

41

Open Reading Frame (ORF)

MNEWPQHTQEDPSSRSPPERYWRAMVAGGVYWGSIIEFVDT

Conservation Score

1

PhyloCSF Frame 1

-5.489

No. of Spectra

6

CPC Coding Probability

0.120482

PhyloCSF Frame 2 

-2.926

CNTI Index

noncoding

Max Probability

0.5387

PhyloCSF Frame 3

-5.448

CNTI Score

-0.331085388