McDonnell Genome Institute

Washington University

Transcript

MIR646HG:31

Chromosome

chr20

Gene Name

MIR646HG

Start

60255794

CPC Label

noncoding

End

60307879

Cancer

CCRC

Strand

+

Peptide

LQHTVWFK

Modified Peptide

n[230]LQHTVWFK

Peptide Length

8

ORF Length

46

Open Reading Frame (ORF)

LQHTVWFKASLVQEDSLIPEAKAGEWQEFKTSLGNKVRPSLYKNNK

Conservation Score

0.152

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.172439

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9947

PhyloCSF Frame 3

0

CNTI Score

-0.344957137