McDonnell Genome Institute

Washington University

Transcript

MIR646HG:19

Chromosome

chr20

Gene Name

MIR646HG

Start

60180878

CPC Label

noncoding

End

60331584

Cancer

OV

Strand

+

Peptide

WFWVGGLHFLSRCCLPSGCR

Modified Peptide

n[145]WFWVGGLHFLSRCCLPSGCR

Peptide Length

20

ORF Length

54

Open Reading Frame (ORF)

MHILTVEPGTQGKDSLGLHCTFSLRSPARRVQTRWFWVGGLHFLSRCCLPSGCR

Conservation Score

0.037

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0243965

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1585

PhyloCSF Frame 3

0

CNTI Score

-0.350118242