McDonnell Genome Institute

Washington University

Transcript

MIR583HG:47

Chromosome

chr5

Gene Name

MIR583HG

Start

96440147

CPC Label

noncoding

End

96442885

Cancer

OV

Strand

+

Peptide

MFLGLCYPK

Modified Peptide

n[145]M[147]FLGLCYPK

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

MFLGLCYPKMLLPFVALVRLGTWKLRELNGQYPWH

Conservation Score

0.01

PhyloCSF Frame 1

-4.482

No. of Spectra

21

CPC Coding Probability

0.0481245

PhyloCSF Frame 2 

-5.738

CNTI Index

noncoding

Max Probability

0.9629

PhyloCSF Frame 3

-4.915

CNTI Score

-0.326945466