McDonnell Genome Institute

Washington University

Transcript

MIR583HG:40

Chromosome

chr5

Gene Name

MIR583HG

Start

96050122

CPC Label

noncoding

End

96065245

Cancer

BRCA-Luminal A

Strand

+

Peptide

LLLPNGGVEK

Modified Peptide

n[145]LLLPNGGVEK

Peptide Length

10

ORF Length

36

Open Reading Frame (ORF)

LLLPNGGVEKSGWHLGGSLGSFLVLLCSILRVNGKV

Conservation Score

0.995

PhyloCSF Frame 1

-5.163

No. of Spectra

13

CPC Coding Probability

0.0774817

PhyloCSF Frame 2 

-3.949

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-4.642

CNTI Score

-0.31264572