McDonnell Genome Institute

Washington University

Transcript

MIR4500HG:1

Chromosome

chr13

Gene Name

MIR4500HG

Start

87615283

CPC Label

noncoding

End

87671273

Cancer

CCRC

Strand

-

Peptide

AWDCAILGLGK

Modified Peptide

AWDCAILGLGK

Peptide Length

11

ORF Length

34

Open Reading Frame (ORF)

MCVIRAWDCAILGLGKGGVEITPAVPGLLVVRNR

Conservation Score

1

PhyloCSF Frame 1

-0.766

No. of Spectra

32

CPC Coding Probability

0.0544002

PhyloCSF Frame 2 

-2.357

CNTI Index

noncoding

Max Probability

0.9939

PhyloCSF Frame 3

1.962

CNTI Score

-0.445549462