McDonnell Genome Institute

Washington University

Transcript

MIR4458HG:9

Chromosome

chr5

Gene Name

MIR4458HG

Start

8457690

CPC Label

noncoding

End

8462072

Cancer

OSCC

Strand

+

Peptide

MCVWLLEEMINSQR

Modified Peptide

n[145]MCVWLLEEM[147]INSQR

Peptide Length

14

ORF Length

37

Open Reading Frame (ORF)

LWLCRGDEGLIWEALRMCVWLLEEMINSQRRQWHPWT

Conservation Score

0.179

PhyloCSF Frame 1

-5.592

No. of Spectra

3

CPC Coding Probability

0.0497917

PhyloCSF Frame 2 

-4.121

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-2.85

CNTI Score

-0.30846396