McDonnell Genome Institute

Washington University

Transcript

MIR4458HG:12

Chromosome

chr5

Gene Name

MIR4458HG

Start

8457690

CPC Label

noncoding

End

8487392

Cancer

OV

Strand

+

Peptide

IFMMIHFHLMNNK

Modified Peptide

n[145]IFM[147]MIHFHLM[147]NNK

Peptide Length

13

ORF Length

58

Open Reading Frame (ORF)

LLLLTPLPSPPYLPPLSPLRQQDQPLVFLLLSLVDAKTTRIKIFMMIHFHLMNNKCIF

Conservation Score

0.018

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.229778

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4148

PhyloCSF Frame 3

0

CNTI Score

-0.353675038