McDonnell Genome Institute

Washington University

Transcript

MIR4453HG:17

Chromosome

chr4

Gene Name

MIR4453HG

Start

152536377

CPC Label

noncoding

End

152546747

Cancer

OV

Strand

+

Peptide

GPTTATATPTATPATTAHTSTLQPA

Modified Peptide

n[145]GPTTATATPTATPATTAHTSTLQPA

Peptide Length

25

ORF Length

212

Open Reading Frame (ORF)

LHIPSRAVTVPRLDPNPILRSEQVLGAGRGQAVGTDTQGLQGQGGLPVPQRVQSAEMPWSCTWEGRAAACCMECAGSPSCACLQPSAGTPGPCWALLCPPLRARPCCSPAGKQLSAAPSQQPPGQWALGTVRLLPTCSPQWQWVIAVIQGQGLEQWRLQYWERVLPGHMRMGTGGSTVVHLGNAGHKGPTTATATPTATPATTAHTSTLQPA

Conservation Score

0.188

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.489986

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3163

PhyloCSF Frame 3

0

CNTI Score

-0.29380028