McDonnell Genome Institute

Washington University

Transcript

MIR4435-2HG:51

Chromosome

chr2

Gene Name

MIR4435-2HG

Start

111036775

CPC Label

noncoding

End

111495046

Cancer

BRCA-Luminal B

Strand

-

Peptide

LPIGHKLR

Modified Peptide

n[145]LPIGHKLR

Peptide Length

8

ORF Length

33

Open Reading Frame (ORF)

MLLLLLVSISPGASLRLPIGHKLRRSLSKQFCV

Conservation Score

0.125

PhyloCSF Frame 1

-4.153

No. of Spectra

61

CPC Coding Probability

0.0126911

PhyloCSF Frame 2 

-4.208

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-3.118

CNTI Score

-0.348253832