McDonnell Genome Institute

Washington University

Transcript

MIR4435-2HG:30

Chromosome

chr2

Gene Name

MIR4435-2HG

Start

111210994

CPC Label

coding

End

111212476

Cancer

OV

Strand

-

Peptide

GSYEKPTANIIFHDK

Modified Peptide

n[145]GSYEKPTANIIFHDK

Peptide Length

15

ORF Length

53

Open Reading Frame (ORF)

LKGSYEKPTANIIFHDKRWSFLTLNSRIREKCLLSPLYLTVLEILASKTDKEK

Conservation Score

0.403

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.638627

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7521

PhyloCSF Frame 3

0

CNTI Score

-0.36035072