McDonnell Genome Institute

Washington University

Transcript

MIR4432HG:7

Chromosome

chr2

Gene Name

MIR4432HG

Start

60350594

CPC Label

noncoding

End

60353016

Cancer

OV

Strand

-

Peptide

SLEDHLGHLLILK

Modified Peptide

n[145]SLEDHLGHLLILK

Peptide Length

13

ORF Length

55

Open Reading Frame (ORF)

LAEGRAGVGRSLEDHLGHLLILKMRRTRLGEDECLVEGCTASWGHSCRKSKSPDS

Conservation Score

0.147

PhyloCSF Frame 1

-3.57

No. of Spectra

4

CPC Coding Probability

0.167204

PhyloCSF Frame 2 

-5.337

CNTI Index

noncoding

Max Probability

0.7995

PhyloCSF Frame 3

-5.512

CNTI Score

-0.333930854