McDonnell Genome Institute

Washington University

Transcript

MIR3976HG:8

Chromosome

chr18

Gene Name

MIR3976HG

Start

5748818

CPC Label

noncoding

End

5795899

Cancer

CCRC

Strand

+

Peptide

LQIFLCQQK

Modified Peptide

n[230]LQIFLCQQK

Peptide Length

9

ORF Length

54

Open Reading Frame (ORF)

LEKLQMQMKKLQIFLCQQKLTDEGDLRIMFLMFMKLVSLSEVNGFKNFSLRKKT

Conservation Score

0.117

PhyloCSF Frame 1

-6.417

No. of Spectra

1

CPC Coding Probability

0.0231636

PhyloCSF Frame 2 

-3.502

CNTI Index

noncoding

Max Probability

0.9966

PhyloCSF Frame 3

-5.085

CNTI Score

-0.319594341