McDonnell Genome Institute

Washington University

Transcript

MIR3976HG:12

Chromosome

chr18

Gene Name

MIR3976HG

Start

5758295

CPC Label

noncoding

End

5795813

Cancer

OV

Strand

+

Peptide

KDLIENSK

Modified Peptide

n[145]KDLIENSK

Peptide Length

8

ORF Length

64

Open Reading Frame (ORF)

LHFSLGKDLLCRKDLIENSKRKLGTITVPSCIGRGDQPHPPQHSTWRGTAAMTIEDTLWIQCQT

Conservation Score

0.892

PhyloCSF Frame 1

-4.162

No. of Spectra

2

CPC Coding Probability

0.0177327

PhyloCSF Frame 2 

-5.096

CNTI Index

noncoding

Max Probability

0.7232

PhyloCSF Frame 3

-3.291

CNTI Score

-0.319594341