McDonnell Genome Institute

Washington University

Transcript

MIR3976HG:1

Chromosome

chr18

Gene Name

MIR3976HG

Start

5747140

CPC Label

noncoding

End

5795901

Cancer

OV

Strand

+

Peptide

QILPQSSFR

Modified Peptide

n[145]QILPQSSFR

Peptide Length

9

ORF Length

49

Open Reading Frame (ORF)

LINSQQGTESLRPTTHKKLKLKQILPQSSFRKEIMSDHSAQGFSADAIQ

Conservation Score

0.103

PhyloCSF Frame 1

-6.372

No. of Spectra

54

CPC Coding Probability

0.0219461

PhyloCSF Frame 2 

-5.587

CNTI Index

noncoding

Max Probability

0.9863

PhyloCSF Frame 3

-5.551

CNTI Score

-0.366120472