McDonnell Genome Institute

Washington University

Transcript

MIR3945HG:4

Chromosome

chr4

Gene Name

MIR3945HG

Start

184843345

CPC Label

noncoding

End

184853545

Cancer

LUAD

Strand

-

Peptide

EPSSTASSR

Modified Peptide

n[230]EPSSTASSR

Peptide Length

9

ORF Length

82

Open Reading Frame (ORF)

LICVMMAPLSSGCHCWHFGQGGLGFCSGAVCPRFTPHYFTAHWSSQQSPKVWRSPMGRREGRGLDIREPSSTASSRSRLSST

Conservation Score

0.379

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.16985

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

0

CNTI Score

-0.340769796